Fatty Acid Binding Protein 5 (FABP5)

Item No.: 42040
Type: Recombinant

Cat. No.: 42040

Tag: His

Size: 0.1 mg

Source: E.Coli

Purity: >95%

Other names: E-FABP; PA-FABP

Species: Mouse
Description
Description

Fatty Acid Binding Protein 5 (FABP5)

★Download Datasheet★

Type: Recombinant

Cat. No.: 42040

Tag: His

Size: 0.1 mg

Source: E.Coli

Purity: >95%

Other names: E-FABP; PA-FABP

Species: Mouse


Introduction
The fatty acid binding proteins (FABPs) are a family of carrier proteins for fatty acids and other lipophilic substances such as
eicosanoids and retinoids. These proteins are thought to facilitate the transfer of fatty acids between extra- and intracellular
membranes. The fatty acid binding protein 4 (FABP-4) and fatty acid binding protein 5(FABP5) are closely related and both are
expressed in adipocytes. Mice with targeted disruption of FABP-4 accompany FABP-5 almost completely protect against
diet-induced obesity, insulin resistance, dyslipidemia, type 2 diabetes, and fatty liver disease. While mice over expressing FABP5 in
adipose have reduced insulin sensitivity.

Description

Total 163 AA. Mw:18.5 kDa (calculated).

N-terminal His-tag and TEV cleavage site, 28 extra AA (highlighted).

Amino Acid Sequence

MSYYHHHHHHDYDIPTTENLYFQGAMGSMASLKDLEGKWRLMESHGFEEYMKELGVGLALRKMA
AMAKPDCIITCDGNNITVKTESTVKTTVFSCNLGEKFDETTADGRKTETVCTFQDGALVQHQQWDG
KESTITRKLKDGKMIVECVMNNATCTRVYEKVQ

Formulation

Lyophilized in 1 mg/mL in PBS.

Reconstitution

Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.

Storage

Store lyophilized protein at -20°C. Aliquot reconstituted protein and store at -80°C. Avoid repeated freezing/thawing cycles.

Quality Control Test

BCA to determine quantity of the protein.

SDS PAGE to determine purity of the protein.

Application

Western blotting.

Send your message to us
please select your country
  • Afghanistan
  • Aland Islands
  • Albania
  • Algeria
  • American Samoa
  • Andorra
  • Angola
  • Anguilla
  • Antigua and Barbuda
  • Argentina
  • Armenia
  • Aruba
  • Australia
  • Austria
  • Azerbaijan
  • Bahamas
  • Bahrain
  • Bangladesh
  • Barbados
  • Belarus
  • Belgium
  • Belize
  • Benin
  • Bermuda
  • Bhutan
  • Bolivia
  • Bosnia and Herzegovina
  • Botswana
  • Bouvet Island
  • Brazil
  • British Indian Ocean Territory
  • British Virgin Islands
  • Brunei Darussalam
  • Bulgaria
  • Burkina Faso
  • Burundi
  • Cambodia
  • Cameroon
  • Canada
  • Cape Verde
  • Caribbean Netherlands
  • Cayman Islands
  • Central African Republic
  • Chad
  • Chile
  • China
  • Christmas Island
  • Cocos Islands
  • Colombia
  • Comoros
  • Congo
  • Cook Islands
  • Costa Rica
  • Cote D'ivoire
  • Cuba
  • Curaçao
  • Cyprus
  • Czech Republic
  • Democratic People's Republic of Korea
  • Democratic Republic of the Congo
  • Denmark
  • Djibouti
  • Dominica
  • East Timor
  • Ecuador
  • Egypt
  • El Salvador
  • Equatorial Guinea
  • Eritrea
  • Estonia
  • Ethiopia
  • Falkland Islands
  • Faroe Islands
  • Fiji
  • Finland
  • France
  • French Guiana
  • French Polynesia
  • French Southern Territories
  • Gabon
  • Gambia
  • Georgia
  • Germany
  • Ghana
  • Gibraltar
  • Greece
  • Greenland
  • Grenada
  • Guadeloupe
  • Guam
  • Guatemala
  • Guernsey
  • Guinea
  • Guinea-Bissau
  • Guyana
  • Haiti
  • Heard Island and Mcdonald Islands
  • Honduras
  • Hong Kong, China
  • Hungary
  • Iceland
  • India
  • Indonesia
  • Iran
  • Iraq
  • Ireland
  • Isle of Man
  • Israel
  • Italy
  • Jamaica
  • Japan
  • Jordan
  • Kazakhstan
  • Kenya
  • Kiribati
  • Korea
  • Kosovo
  • Kuwait
  • Kyrgyzstan
  • Laos
  • Latvia
  • Lebanon
  • Lesotho
  • Liberia
  • Liechtenstein
  • Lithuania
  • Luxembourg
  • Macau, China
  • Macedonia
  • Madagascar
  • Malawi
  • Malaysia
  • Maldives
  • Mali
  • Malta
  • Marshall Islands
  • Martinique
  • Mauritania
  • Mauritius
  • Mayotte
  • Mexico
  • Micronesia
  • Moldova
  • Monaco
  • Mongolia
  • Montenegro
  • Montserrat
  • Morocco
  • Mozambique
  • Myanmar
  • Namibia
  • Nauru
  • Nepal
  • Netherlands
  • Netherlands Antilles
  • New Caledonia
  • New Zealand
  • Nicaragua
  • Niger
  • Nigeria
  • Niue
  • Norfolk Island
  • Northern Mariana Islands
  • Norway
  • Oman
  • Pakistan
  • Palau
  • Palestine
  • Panama
  • Papua New Guinea
  • Paraguay
  • Peru
  • Philippines
  • Pitcairn Islands
  • Poland
  • Portugal
  • Puerto Rico
  • Qatar
  • Reunion
  • Romania
  • Russia
  • Rwanda
  • Saint Barthélemy
  • Saint Helena
  • Saint Kitts and Nevis
  • Saint Lucia
  • Saint Martin
  • Saint Pierre and Miquelon
  • Saint Vincent and the Grenadines
  • San Marino
  • Sao Tome and Principe
  • Saudi Arabia
  • Senegal
  • Serbia
  • Seychelles
  • Sierra Leone
  • Singapore
  • Sint Maarten
  • Slovakia
  • Slovenia
  • Solomon Islands
  • Somalia
  • South Africa
  • South Georgia and The South Sandwich Islands
  • Spain
  • Sri Lanka
  • State of Libya
  • Sudan
  • Suriname
  • Svalbard and Jan Mayen
  • Swaziland
  • Sweden
  • Switzerland
  • Syrian Arab Republic
  • TaiWan, China
  • Tajikistan
  • Tanzania
  • Thailand
  • The Republic of Croatia
  • Togo
  • Tokelau
  • Tonga
  • Trinidad and Tobago
  • Tunisia
  • Turkey
  • Turkmenistan
  • Turks and Caicos Islands
  • Tuvalu
  • Uganda
  • Ukraine
  • United Arab Emirates
  • United Kingdom
  • United States
  • United States Minor Outlying Islands
  • Uruguay
  • US Virgin Islands
  • Uzbekistan
  • Vanuatu
  • Vatican City State
  • Venezuela
  • Vietnam
  • Wallis and Futuna Islands
  • Western Sahara
  • Western Samoa
  • Yemen
  • Zambia
  • Zimbabwe
ver_code