Type: Recombinant |
Cat. No.: 42010 |
Tag: His |
Size: 0.1 mg |
Source: E.Coli |
Purity: >90% |
Other names: Acrp30, GBP28, AdipoQ |
Species: Mouse |
Introduction
Adiponectin, also known as apM1, Acrp30, GBP28 and adipoQ, is a circulating hormone predominantly produced from adipose
tissue. Many pharmacological studies demonstrated that this protein possesses potent anti-diabetic, anti- atherogenic and
anti-inflammatory functions. Supplement of adiponectin protein can decrease blood glucose, improve insulin sensitivity, alleviate fatty liver and prevent atherosclerosis. The protein is post-translationally modified by hydroxylation and glycosylation, and forms three
different oligomeric complexes in the circulation. Many clinical studies demonstrated that plasma adiponectin is an useful biomarker
for metabolic syndrome, nonalcoholic steatohepatitis and certain type of cancers. Decreased circulating levels of plasma adiponectin (hypoadiponectinaemia) are associated with increased body mass index (BMI), decreased insulin sensitivity, less favourable plasma
lipid profiles, increased levels of inflammatory markers and increased risk for the development of type 2 diabetes, hypertension, and coronary heart diseases. Low adiponectin concentrations were found to be predictive of a future reduction in insulin sensitivity and
cardiovascular disorders. Administration of the anti-diabetic drugs thiazolidinediones (TZDs) raises circulating adiponectin levels. In
addition, low plasma adiponectin levels are also associated with nonalcoholic steatohepatitis (NASH) and certain types of cancers.
Description
Total 258 AA. Mw: 28.3 kDa (calculated).
N-terminal His-tag and TEV cleavage site, 28 extra AA (highlighted).
Amino Acid Sequence
MSYYHHHHHHDYDIPTTENLYFQGAMGSEDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGH
NGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYM
YRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVY
Formulation
Lyophilized in 1 mg/mL in PBS.
Reconstitution
Add deionized water to prepare a working stock solution of approximately 1 mg/mL and let the lyophilized pellet dissolve completely.
Storage
Store lyophilized protein at -20°C. Aliquot reconstituted protein and store at -80°C. Avoid repeated freezing/thawing cycles.
Quality Control Test
BCA to determine quantity of the protein.
SDS PAGE to determine purity of the protein.
Application
Cell culture and/or animal studies, ELISA, Western blotting.
Endotoxin Level
<0.2 EU/μg.